SCOPe 2.07: Domain d5wi7a_: 5wi7 A:

Lineage for d5wi7a_ (5wi7 A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Acinetobacter sp. [TaxId:1182652] [348104] (3 PDB entries)

8. Domain d5wi7a_: 5wi7 A: [348170]
   automated match to d4x55a_
   complexed with 4j6

Details for d5wi7a_

PDB Entry: 5wi7, 1.86 Å

PDB Description: structure of acinetobacter baumannii carbapenemase oxa-239 k82d bound to doripenem

PDB Compounds: (A:) oxa-239

SCOPe Domain Sequences for d5wi7a_:

Sequence; same for both SEQRES and ATOM records:

>d5wi7a_ e.3.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 1182652]}
qivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfdmlnaligl
enqktdineifkwkgekrlftawekdmtlgeamklsavpvyqelarrigldlmqkevkri
gfgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesng
ykifgktgwamniksqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkql
nii

Timeline for d5wi7a_:

• d5wi7a_ is new in SCOPe 2.07-stable
  
• d5wi7a_ appears in the current release, SCOPe 2.08