Lineage for d5w4vb_ (5w4v B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343162Domain d5w4vb_: 5w4v B: [348102]
    automated match to d5aygb_
    complexed with 9wa

Details for d5w4vb_

PDB Entry: 5w4v (more details), 2.65 Å

PDB Description: structure of rorgt bound to a tertiary alcohol
PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5w4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w4vb_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
elafhhhlhkthrqsilaklppkgklrsl

SCOPe Domain Coordinates for d5w4vb_:

Click to download the PDB-style file with coordinates for d5w4vb_.
(The format of our PDB-style files is described here.)

Timeline for d5w4vb_: