Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
Protein automated matches [231324] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [348042] (1 PDB entry) |
Domain d5vtpa2: 5vtp A:390-509 [348043] Other proteins in same PDB: d5vtpa1, d5vtpa3 automated match to d3ohba2 complexed with mg |
PDB Entry: 5vtp (more details), 2.8 Å
SCOPe Domain Sequences for d5vtpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtpa2 d.240.1.0 (A:390-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii
Timeline for d5vtpa2: