Lineage for d5vtpa2 (5vtp A:390-509)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. 3008521Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [348042] (1 PDB entry)
  8. 3008522Domain d5vtpa2: 5vtp A:390-509 [348043]
    Other proteins in same PDB: d5vtpa1, d5vtpa3
    automated match to d3ohba2
    complexed with mg

Details for d5vtpa2

PDB Entry: 5vtp (more details), 2.8 Å

PDB Description: x-ray diffraction data of dna polymerase eta (rad30) of saccharomyces cerevisiae with a single magnesium bound in absence of dna and incoming dntp
PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d5vtpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtpa2 d.240.1.0 (A:390-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii

SCOPe Domain Coordinates for d5vtpa2:

Click to download the PDB-style file with coordinates for d5vtpa2.
(The format of our PDB-style files is described here.)

Timeline for d5vtpa2: