Lineage for d5ucxc1 (5ucx C:1-194)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485823Protein automated matches [190100] (20 species)
    not a true protein
  7. 2486109Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries)
  8. 2486176Domain d5ucxc1: 5ucx C:1-194 [347836]
    Other proteins in same PDB: d5ucxa2, d5ucxb2, d5ucxc2, d5ucxd2, d5ucxe2, d5ucxf2, d5ucxg2, d5ucxh2, d5ucxi2
    automated match to d3tkra_

Details for d5ucxc1

PDB Entry: 5ucx (more details), 2.4 Å

PDB Description: structure of s78c human peroxiredoxin 3 as three stacked rings
PDB Compounds: (C:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d5ucxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucxc1 c.47.1.10 (C:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apavtqhapyfkgtavvngefkdlslddfkgkylvlffypldftfvcpteivafsdkane
fhdvncevvavsvdshfchlawintprkngglghmniallsdltkqisrdygvllegsgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqyvethgevcpanwtpdsptik
pspaaskeyfqkvn

SCOPe Domain Coordinates for d5ucxc1:

Click to download the PDB-style file with coordinates for d5ucxc1.
(The format of our PDB-style files is described here.)

Timeline for d5ucxc1: