SCOP 1.75: Domain d3lipa_: 3lip A:

Lineage for d3lipa_ (3lip A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (3 proteins)
   lack the first two strands of the common fold

6. Protein Lipase [53571] (4 species)

7. Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [63399] (7 PDB entries)

8. Domain d3lipa_: 3lip A: [34778]
   open conformation
   complexed with ca

Details for d3lipa_

PDB Entry: 3lip, 2 Å

PDB Description: open conformation of pseudomonas cepacia lipase

PDB Compounds: (A:) triacyl-glycerol-hydrolase

SCOP Domain Sequences for d3lipa_:

Sequence; same for both SEQRES and ATOM records:

>d3lipa_ c.69.1.18 (A:) Lipase {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv

Timeline for d3lipa_:

• d3lipa_ first appeared (with stable ids) in SCOP 1.55, called d3lip__
  
• d3lipa_ appears in SCOP 1.73
  
• d3lipa_ appears in SCOPe 2.01
  
• d3lipa_ appears in the current release, SCOPe 2.08