Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d5umsa_: 5ums A: [347714] automated match to d4pq0a_ |
PDB Entry: 5ums (more details), 1.57 Å
SCOPe Domain Sequences for d5umsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5umsa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qatgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrq mffvisldppikqgqtryhflillfskdedisltlnmneeevekrfegrltknmsgslye mvsrvmkalvnrkitvpgnfqghsgaqcitcsykassgllyplergfiyvhkppvhirfd eisfvnfargttttrsfdfeietkqgtqytfssiereeygklfdfvnakklniknrgl
Timeline for d5umsa_: