Lineage for d5o7lb1 (5o7l B:1-47)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542785Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2542808Protein automated matches [190339] (1 species)
    not a true protein
  7. 2542809Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (12 PDB entries)
  8. 2542836Domain d5o7lb1: 5o7l B:1-47 [347311]
    Other proteins in same PDB: d5o7la2, d5o7lb2
    automated match to d1iv7a_
    complexed with so4; mutant

Details for d5o7lb1

PDB Entry: 5o7l (more details), 2.6 Å

PDB Description: crystal structure of a single chain monellin mutant (y65r) ph 4.6
PDB Compounds: (B:) Monellin chain B

SCOPe Domain Sequences for d5o7lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o7lb1 d.17.1.1 (B:1-47) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiy

SCOPe Domain Coordinates for d5o7lb1:

Click to download the PDB-style file with coordinates for d5o7lb1.
(The format of our PDB-style files is described here.)

Timeline for d5o7lb1:

  • d5o7lb1 is new in SCOPe 2.07-stable
  • d5o7lb1 does not appear in SCOPe 2.08

View in 3D
Domains from same chain:
(mouse over for more information)
d5o7lb2