SCOPe 2.07: Domain d5oisd1: 5ois D:3-269

Lineage for d5oisd1 (5ois D:3-269)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (94 PDB entries)

8. Domain d5oisd1: 5ois D:3-269 [347142]
   Other proteins in same PDB: d5oisb2, d5oisd2, d5oisf2, d5oish2
   automated match to d2h9ia_
   complexed with 9wk, nad; mutant

Details for d5oisd1

PDB Entry: 5ois, 2.24 Å

PDB Description: inha (t2a mutant) complexed with 4-((5-amino-3-methyl-1h-pyrazol-1- yl)methyl)-n-(2-chloro-4-fluorobenzyl)benzamide

PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5oisd1:

Sequence; same for both SEQRES and ATOM records:

>d5oisd1 c.2.1.2 (D:3-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

Timeline for d5oisd1:

• d5oisd1 is new in SCOPe 2.07-stable
  
• d5oisd1 appears in the current release, SCOPe 2.08