Lineage for d1ek2b2 (1ek2 B:226-544)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842313Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 842323Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 842331Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)
  8. 842339Domain d1ek2b2: 1ek2 B:226-544 [34692]
    Other proteins in same PDB: d1ek2a1, d1ek2b1
    complexed with cdu

Details for d1ek2b2

PDB Entry: 1ek2 (more details), 3 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor
PDB Compounds: (B:) epoxide hydrolase

SCOP Domain Sequences for d1ek2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek2b2 c.69.1.11 (B:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

SCOP Domain Coordinates for d1ek2b2:

Click to download the PDB-style file with coordinates for d1ek2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ek2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ek2b1