Lineage for d1cqzb2 (1cqz B:226-544)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248565Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 248566Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 248791Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 248801Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (1 species)
  7. 248802Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)
  8. 248806Domain d1cqzb2: 1cqz B:226-544 [34690]
    Other proteins in same PDB: d1cqza1, d1cqzb1

Details for d1cqzb2

PDB Entry: 1cqz (more details), 2.8 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase.

SCOP Domain Sequences for d1cqzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqzb2 c.69.1.11 (B:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus)}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

SCOP Domain Coordinates for d1cqzb2:

Click to download the PDB-style file with coordinates for d1cqzb2.
(The format of our PDB-style files is described here.)

Timeline for d1cqzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cqzb1