Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Neisseria polysaccharea [TaxId:489] [226281] (7 PDB entries) |
Domain d5n6va2: 5n6v A:555-628 [346889] Other proteins in same PDB: d5n6va1, d5n6va3 automated match to d1g5aa1 complexed with 1pe, epe, fru, glc, pge, trs; mutant |
PDB Entry: 5n6v (more details), 1.6 Å
SCOPe Domain Sequences for d5n6va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n6va2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]} rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktislnqd ltlqpyqvmwleia
Timeline for d5n6va2: