Lineage for d5n6va2 (5n6v A:555-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811134Species Neisseria polysaccharea [TaxId:489] [226281] (7 PDB entries)
  8. 2811135Domain d5n6va2: 5n6v A:555-628 [346889]
    Other proteins in same PDB: d5n6va1, d5n6va3
    automated match to d1g5aa1
    complexed with 1pe, epe, fru, glc, pge, trs; mutant

Details for d5n6va2

PDB Entry: 5n6v (more details), 1.6 Å

PDB Description: crystal structure of neisseria polysaccharea amylosucrase mutant derived from neutral genetic drift-based engineering
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d5n6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n6va2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktislnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d5n6va2:

Click to download the PDB-style file with coordinates for d5n6va2.
(The format of our PDB-style files is described here.)

Timeline for d5n6va2: