Lineage for d1ek1a2 (1ek1 A:226-544)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184304Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 184305Superfamily c.69.1: alpha/beta-Hydrolases [53474] (23 families) (S)
  5. 184490Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 184500Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (1 species)
  7. 184501Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)
  8. 184502Domain d1ek1a2: 1ek1 A:226-544 [34685]
    Other proteins in same PDB: d1ek1a1, d1ek1b1

Details for d1ek1a2

PDB Entry: 1ek1 (more details), 2 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor

SCOP Domain Sequences for d1ek1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek1a2 c.69.1.11 (A:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus)}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

SCOP Domain Coordinates for d1ek1a2:

Click to download the PDB-style file with coordinates for d1ek1a2.
(The format of our PDB-style files is described here.)

Timeline for d1ek1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ek1a1