Lineage for d5n5vg1 (5n5v G:1-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860283Protein automated matches [190581] (10 species)
    not a true protein
  7. 2860310Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (20 PDB entries)
  8. 2860337Domain d5n5vg1: 5n5v G:1-306 [346831]
    Other proteins in same PDB: d5n5va2, d5n5vb2, d5n5vd2, d5n5ve2, d5n5vf2, d5n5vg2, d5n5vh2
    automated match to d1u7xa_
    complexed with cl

Details for d5n5vg1

PDB Entry: 5n5v (more details), 2.3 Å

PDB Description: structure of p-boronophenylalanyl trna synthetase - apo form
PDB Compounds: (G:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d5n5vg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n5vg1 c.26.1.1 (G:1-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefelikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
diiialadlmaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnsihyegvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
pirkrl

SCOPe Domain Coordinates for d5n5vg1:

Click to download the PDB-style file with coordinates for d5n5vg1.
(The format of our PDB-style files is described here.)

Timeline for d5n5vg1: