Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:316058] [193594] (35 PDB entries) |
Domain d5kdba_: 5kdb A: [346659] automated match to d4egoa_ complexed with 4ia, cl, hem |
PDB Entry: 5kdb (more details), 1.64 Å
SCOPe Domain Sequences for d5kdba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kdba_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]} tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala rkvaaididgpvkrrfnntlrgleslpvkltpa
Timeline for d5kdba_: