![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
![]() | Protein Thermophilic para-nitrobenzyl esterase (PNB esterase) [53485] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [53486] (4 PDB entries) |
![]() | Domain d1c7ia_: 1c7i A: [34632] complexed with ca |
PDB Entry: 1c7i (more details), 2 Å
SCOPe Domain Sequences for d1c7ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ia_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldatvygpvc pqpsdllslsykelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip lligttrdegyffftpdsdvysqetldaaleyllgkplaekvadlyprslesqihmvtdl lfwrpavafasaqshyapvwmyrfdwhpekppynkafhtlelpfvfgnldelermakaei tdevkqlshtiqsawttfaktgnpsteavnwpayheesretvildseitiendpesekrq klf
Timeline for d1c7ia_: