Lineage for d1c7ia_ (1c7i A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26620Family c.69.1.1: Acetylcholinesterase-like [53475] (3 proteins)
  6. 26679Protein Thermophylic para-nitrobenzyl esterase (PNB esterase) [53485] (1 species)
  7. 26680Species Bacillus subtilis [TaxId:1423] [53486] (3 PDB entries)
  8. 26683Domain d1c7ia_: 1c7i A: [34632]

Details for d1c7ia_

PDB Entry: 1c7i (more details), 2 Å

PDB Description: thermophylic pnb esterase

SCOP Domain Sequences for d1c7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ia_ c.69.1.1 (A:) Thermophylic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis}
thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldatvygpvc
pqpsdllslsykelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd
nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
lligttrdegyffftpdsdvysqetldaaleyllgkplaekvadlyprslesqihmvtdl
lfwrpavafasaqshyapvwmyrfdwhpekppynkafhtlelpfvfgnldelermakaei
tdevkqlshtiqsawttfaktgnpsteavnwpayheesretvildseitiendpesekrq
klf

SCOP Domain Coordinates for d1c7ia_:

Click to download the PDB-style file with coordinates for d1c7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ia_: