Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.7: Mob1/phocein [101152] (2 families) common fold is elaborated with additional short helices; contains a zinc-binding site automatically mapped to Pfam PF03637 |
Family a.29.7.1: Mob1/phocein [101153] (2 proteins) |
Protein automated matches [319235] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries) |
Domain d5twha1: 5twh A:22-211 [345853] automated match to d5twfa_ complexed with zn |
PDB Entry: 5twh (more details), 2.5 Å
SCOPe Domain Sequences for d5twha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5twha1 a.29.7.1 (A:22-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcte ascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfp knfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrel aplqeliekl
Timeline for d5twha1: