Lineage for d5twha1 (5twh A:22-211)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2322039Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2322040Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2322046Protein automated matches [319235] (2 species)
    not a true protein
  7. 2322047Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries)
  8. 2322052Domain d5twha1: 5twh A:22-211 [345853]
    automated match to d5twfa_
    complexed with zn

Details for d5twha1

PDB Entry: 5twh (more details), 2.5 Å

PDB Description: human mob1a bound to mst1 phosphorylated t367 peptide
PDB Compounds: (A:) MOB kinase activator 1A

SCOPe Domain Sequences for d5twha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5twha1 a.29.7.1 (A:22-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcte
ascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfp
knfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrel
aplqeliekl

SCOPe Domain Coordinates for d5twha1:

Click to download the PDB-style file with coordinates for d5twha1.
(The format of our PDB-style files is described here.)

Timeline for d5twha1: