Lineage for d1e5ka_ (1e5k A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506299Family c.68.1.8: Molybdenum cofactor biosynthesis protein MobA [53470] (1 protein)
    automatically mapped to Pfam PF12804
  6. 2506300Protein Molybdenum cofactor biosynthesis protein MobA [53471] (2 species)
  7. 2506303Species Escherichia coli [TaxId:562] [53472] (8 PDB entries)
  8. 2506304Domain d1e5ka_: 1e5k A: [34578]
    complexed with cit, li

Details for d1e5ka_

PDB Entry: 1e5k (more details), 1.35 Å

PDB Description: crystal structure of the molybdenum cofactor biosynthesis protein moba (protein fa) from escherichia coli at near atomic resolution
PDB Compounds: (A:) molybdopterin-guanine dinucleotide biosynthesis protein a

SCOPe Domain Sequences for d1e5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]}
mttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiyqa
sglkviedsladypgplagmlsvmqqeagewflfcpcdtpyippdlaarlnhqrkdapvv
wvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnvnt
peelarwq

SCOPe Domain Coordinates for d1e5ka_:

Click to download the PDB-style file with coordinates for d1e5ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e5ka_: