Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.8: Molybdenum cofactor biosynthesis protein MobA [53470] (1 protein) automatically mapped to Pfam PF12804 |
Protein Molybdenum cofactor biosynthesis protein MobA [53471] (2 species) |
Species Escherichia coli [TaxId:562] [53472] (8 PDB entries) |
Domain d1e5ka_: 1e5k A: [34578] complexed with cit, li |
PDB Entry: 1e5k (more details), 1.35 Å
SCOPe Domain Sequences for d1e5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} mttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiyqa sglkviedsladypgplagmlsvmqqeagewflfcpcdtpyippdlaarlnhqrkdapvv wvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnvnt peelarwq
Timeline for d1e5ka_: