Lineage for d4zbqa1 (4zbq A:4-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337067Species Horse (Equus caballus) [TaxId:9796] [256129] (19 PDB entries)
  8. 2337077Domain d4zbqa1: 4zbq A:4-195 [345526]
    automated match to d1hk5a2
    complexed with act, dif, lmr, sin, tla

Details for d4zbqa1

PDB Entry: 4zbq (more details), 1.92 Å

PDB Description: crystal structure of equine serum albumin in complex with diclofenac
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4zbqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbqa1 a.126.1.0 (A:4-195) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddkagclipklda
lkerillssake

SCOPe Domain Coordinates for d4zbqa1:

Click to download the PDB-style file with coordinates for d4zbqa1.
(The format of our PDB-style files is described here.)

Timeline for d4zbqa1:

  • d4zbqa1 is new in SCOPe 2.07-stable