![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
![]() | Family c.6.2.0: automated matches [195981] (1 protein) not a true family |
![]() | Protein automated matches [195982] (7 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [346279] (1 PDB entry) |
![]() | Domain d4m1bb_: 4m1b B: [345341] automated match to d5lgca_ complexed with pge |
PDB Entry: 4m1b (more details), 1.99 Å
SCOPe Domain Sequences for d4m1bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m1bb_ c.6.2.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kviykgdtskkqvaftfdiswgdkkaipildtlkerdiknatfflsaawaerhpdvveri ikdgheigsmgynytsytsletneirrdllraqdvftklgvkqikllrppsgdfnkatlk iaeslgytvvhwsnnsndwknpgvnkivstvsnnlkggdivllhasdsalqtnkalplll qklksdgyeqisvsqlisnt
Timeline for d4m1bb_: