Lineage for d4m1bb_ (4m1b B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850731Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 2850732Protein automated matches [195982] (7 species)
    not a true protein
  7. 2850733Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [346279] (1 PDB entry)
  8. 2850735Domain d4m1bb_: 4m1b B: [345341]
    automated match to d5lgca_
    complexed with pge

Details for d4m1bb_

PDB Entry: 4m1b (more details), 1.99 Å

PDB Description: Structural Determination of BA0150, a Polysaccharide Deacetylase from Bacillus anthracis
PDB Compounds: (B:) polysaccharide deacetylase

SCOPe Domain Sequences for d4m1bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1bb_ c.6.2.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kviykgdtskkqvaftfdiswgdkkaipildtlkerdiknatfflsaawaerhpdvveri
ikdgheigsmgynytsytsletneirrdllraqdvftklgvkqikllrppsgdfnkatlk
iaeslgytvvhwsnnsndwknpgvnkivstvsnnlkggdivllhasdsalqtnkalplll
qklksdgyeqisvsqlisnt

SCOPe Domain Coordinates for d4m1bb_:

Click to download the PDB-style file with coordinates for d4m1bb_.
(The format of our PDB-style files is described here.)

Timeline for d4m1bb_: