SCOPe 2.08: Domain d4m1bb_: 4m1b B:

Lineage for d4m1bb_ (4m1b B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.0: automated matches [195981] (1 protein)
   not a true family

6. Protein automated matches [195982] (7 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [346279] (1 PDB entry)

8. Domain d4m1bb_: 4m1b B: [345341]
   automated match to d5lgca_
   complexed with pge

Details for d4m1bb_

PDB Entry: 4m1b, 1.99 Å

PDB Description: Structural Determination of BA0150, a Polysaccharide Deacetylase from Bacillus anthracis

PDB Compounds: (B:) polysaccharide deacetylase

SCOPe Domain Sequences for d4m1bb_:

Sequence; same for both SEQRES and ATOM records:

>d4m1bb_ c.6.2.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kviykgdtskkqvaftfdiswgdkkaipildtlkerdiknatfflsaawaerhpdvveri
ikdgheigsmgynytsytsletneirrdllraqdvftklgvkqikllrppsgdfnkatlk
iaeslgytvvhwsnnsndwknpgvnkivstvsnnlkggdivllhasdsalqtnkalplll
qklksdgyeqisvsqlisnt

Timeline for d4m1bb_:

• d4m1bb_ first appeared in SCOPe 2.07