SCOPe 2.08: Domain d4ld0a_: 4ld0 A:

Lineage for d4ld0a_ (4ld0 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.6: RuvC resolvase [53134] (2 proteins)
   automatically mapped to Pfam PF02075

6. Protein RuvC resolvase [53135] (2 species)
   Holliday junction-specific endonuclease

7. Species Thermus thermophilus [TaxId:300852] [346310] (3 PDB entries)

8. Domain d4ld0a_: 4ld0 A: [345335]
   Other proteins in same PDB: d4ld0b2
   protein/DNA complex

Details for d4ld0a_

PDB Entry: 4ld0, 3.75 Å

PDB Description: t. thermophilus ruvc in complex with holliday junction substrate

PDB Compounds: (A:) Crossover junction endodeoxyribonuclease RuvC

SCOPe Domain Sequences for d4ld0a_:

Sequence, based on SEQRES records:

>d4ld0a_ c.55.3.6 (A:) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
rfrpeavavqeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
akeevalmvrgilglkeaprpshladalaialthafyarmgtakpl

Sequence, based on observed residues (ATOM records):

>d4ld0a_ c.55.3.6 (A:) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavegalkarllhgevvktspqepakervgriharvlevlhrf
rpeavavqeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalakeevalm
vrgilglkeaprpshladalaialthafyarmgtakpl

Timeline for d4ld0a_:

• d4ld0a_ first appeared in SCOPe 2.07