Lineage for d1fxjb2 (1fxj B:3-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898402Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins)
  6. 2898403Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (3 species)
  7. 2898404Species Escherichia coli [TaxId:562] [53463] (6 PDB entries)
  8. 2898414Domain d1fxjb2: 1fxj B:3-251 [34521]
    Other proteins in same PDB: d1fxja1, d1fxjb1
    complexed with mes, so4

Details for d1fxjb2

PDB Entry: 1fxj (more details), 2.25 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase
PDB Compounds: (B:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d1fxjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxjb2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]}
nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
qaeklllag

SCOPe Domain Coordinates for d1fxjb2:

Click to download the PDB-style file with coordinates for d1fxjb2.
(The format of our PDB-style files is described here.)

Timeline for d1fxjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fxjb1