Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Streptococcus agalactiae [TaxId:216495] [346168] (2 PDB entries) |
Domain d3keqa1: 3keq A:6-80 [344859] Other proteins in same PDB: d3keqa2, d3keqb2 automated match to d1r72f3 protein/DNA complex; complexed with nad |
PDB Entry: 3keq (more details), 2.4 Å
SCOPe Domain Sequences for d3keqa1:
Sequence, based on SEQRES records: (download)
>d3keqa1 a.4.5.0 (A:6-80) automated matches {Streptococcus agalactiae [TaxId: 216495]} sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelgrrgfg ydvkklmnffaeiln
>d3keqa1 a.4.5.0 (A:6-80) automated matches {Streptococcus agalactiae [TaxId: 216495]} sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgeydvkklm nffaeiln
Timeline for d3keqa1: