Lineage for d3keqa1 (3keq A:6-80)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308505Species Streptococcus agalactiae [TaxId:216495] [346168] (2 PDB entries)
  8. 2308508Domain d3keqa1: 3keq A:6-80 [344859]
    Other proteins in same PDB: d3keqa2, d3keqb2
    automated match to d1r72f3
    protein/DNA complex; complexed with nad

Details for d3keqa1

PDB Entry: 3keq (more details), 2.4 Å

PDB Description: crystal structure of a rex-family transcriptional regulatory protein from streptococcus agalactiae complexed with nad+
PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3keqa1:

Sequence, based on SEQRES records: (download)

>d3keqa1 a.4.5.0 (A:6-80) automated matches {Streptococcus agalactiae [TaxId: 216495]}
sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelgrrgfg
ydvkklmnffaeiln

Sequence, based on observed residues (ATOM records): (download)

>d3keqa1 a.4.5.0 (A:6-80) automated matches {Streptococcus agalactiae [TaxId: 216495]}
sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgeydvkklm
nffaeiln

SCOPe Domain Coordinates for d3keqa1:

Click to download the PDB-style file with coordinates for d3keqa1.
(The format of our PDB-style files is described here.)

Timeline for d3keqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3keqa2