SCOPe 2.07: Domain d3h43j2: 3h43 J:91-149

Lineage for d3h43j2 (3h43 J:91-149)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.17: Proteasome regulatory subunits PAN/Rpt, OB-fold domain [345919] (1 family)

5. Family b.40.17.1: Proteasome regulatory subunits PAN/Rpt, OB-fold domain [345962] (1 protein)

6. Protein Proteasome-activating nucleotidase PAN, OB-fold domain [346052] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [346244] (1 PDB entry)

8. Domain d3h43j2: 3h43 J:91-149 [344755]
   Other proteins in same PDB: d3h43a1, d3h43b1, d3h43c1, d3h43d1, d3h43e1, d3h43f1, d3h43g1, d3h43h1, d3h43h3, d3h43i1, d3h43i3, d3h43j1, d3h43k1, d3h43k3, d3h43l1, d3h43l3

Details for d3h43j2

PDB Entry: 3h43, 2.1 Å

PDB Description: N-terminal domain of the proteasome-activating nucleotidase of Methanocaldococcus jannaschii

PDB Compounds: (J:) Proteasome-activating nucleotidase

SCOPe Domain Sequences for d3h43j2:

Sequence; same for both SEQRES and ATOM records:

>d3h43j2 b.40.17.1 (J:91-149) Proteasome-activating nucleotidase PAN, OB-fold domain {Methanocaldococcus jannaschii [TaxId: 2190]}
plivgtvvdkvgerkvvvksstgpsflvnvshfvnpddlapgkrvclnqqtltvvdvlp

Timeline for d3h43j2:

• d3h43j2 is new in SCOPe 2.07-stable
  
• d3h43j2 appears in the current release, SCOPe 2.08