SCOPe 2.07: Domain d1bjob_: 1bjo B:

Lineage for d1bjob_ (1bjo B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)

7. Species Escherichia coli [TaxId:562] [53428] (2 PDB entries)

8. Domain d1bjob_: 1bjo B: [34472]
   complexed with plp

Details for d1bjob_

PDB Entry: 1bjo, 2.8 Å

PDB Description: the structure of phosphoserine aminotransferase from e. coli in complex with alpha-methyl-l-glutamate

PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d1bjob_:

Sequence; same for both SEQRES and ATOM records:

>d1bjob_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]}
qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg

Timeline for d1bjob_:

• d1bjob_ first appeared (with stable ids) in SCOP 1.55
  
• d1bjob_ appears in SCOPe 2.06
  
• d1bjob_ appears in the current release, SCOPe 2.08