SCOPe 2.07: Domain d1abmb4: 1abm B:84-198

Lineage for d1abmb4 (1abm B:84-198)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d1abmb4: 1abm B:84-198 [344505]
   Other proteins in same PDB: d1abma3, d1abmb3
   automated match to d1msda2
   complexed with mn

Details for d1abmb4

PDB Entry: 1abm, 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles

PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1abmb4:

Sequence; same for both SEQRES and ATOM records:

>d1abmb4 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1abmb4:

• d1abmb4 is new in SCOPe 2.07-stable
  
• d1abmb4 appears in the current release, SCOPe 2.08