Lineage for d1elqa_ (1elq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380298Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1380410Protein Cystine C-S lyase C-des [53415] (1 species)
  7. 1380411Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries)
  8. 1380414Domain d1elqa_: 1elq A: [34436]
    complexed with k, plp

Details for d1elqa_

PDB Entry: 1elq (more details), 1.8 Å

PDB Description: crystal structure of the cystine c-s lyase c-des
PDB Compounds: (A:) l-cysteine/l-cystine c-s lyase

SCOPe Domain Sequences for d1elqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elqa_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]}
qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
hyitdeeeinhllarladfgp

SCOPe Domain Coordinates for d1elqa_:

Click to download the PDB-style file with coordinates for d1elqa_.
(The format of our PDB-style files is described here.)

Timeline for d1elqa_: