Lineage for d1elqa_ (1elq A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26361Family c.67.1.3: Cystathionine synthase-like [53402] (6 proteins)
  6. 26401Protein Cystine C-S lyase [53415] (1 species)
  7. 26402Species Synechocystis sp. [TaxId:1143] [53416] (2 PDB entries)
  8. 26405Domain d1elqa_: 1elq A: [34436]

Details for d1elqa_

PDB Entry: 1elq (more details), 1.8 Å

PDB Description: crystal structure of the cystine c-s lyase c-des

SCOP Domain Sequences for d1elqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elqa_ c.67.1.3 (A:) Cystine C-S lyase {Synechocystis sp.}
qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
hyitdeeeinhllarladfgp

SCOP Domain Coordinates for d1elqa_:

Click to download the PDB-style file with coordinates for d1elqa_.
(The format of our PDB-style files is described here.)

Timeline for d1elqa_: