Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries) |
Domain d5k3gb2: 5k3g B:297-483 [344306] Other proteins in same PDB: d5k3ga1, d5k3gb1, d5k3gc1, d5k3gd1 automated match to d5k3ic2 |
PDB Entry: 5k3g (more details), 2.86 Å
SCOPe Domain Sequences for d5k3gb2:
Sequence, based on SEQRES records: (download)
>d5k3gb2 a.29.3.0 (B:297-483) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ymltgqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqf agaetvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysm asyiseiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarsep tslidrv
>d5k3gb2 a.29.3.0 (B:297-483) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ymltgqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqf agaetvklyervladlhaltsglksvvthqtgegieqarmacgghgysmasyiseiygva igmvmllqlarylvksaalvksgkasqlgplvaylgarseptslidrv
Timeline for d5k3gb2: