SCOPe 2.08: Domain d4zqka_: 4zqk A:

Lineage for d4zqka_ (4zqk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4zqka_: 4zqk A: [344139]
   Other proteins in same PDB: d4zqkb_
   automated match to d5jdsa_
   complexed with na

Details for d4zqka_

PDB Entry: 4zqk, 2.45 Å

PDB Description: structure of the complex of human programmed death-1 (pd-1) and its ligand pd-l1.

PDB Compounds: (A:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d4zqka_:

Sequence; same for both SEQRES and ATOM records:

>d4zqka_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvna

Timeline for d4zqka_:

• d4zqka_ first appeared in SCOPe 2.07