SCOPe 2.08: Domain d4zqkb_: 4zqk B:

Lineage for d4zqkb_ (4zqk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries)

8. Domain d4zqkb_: 4zqk B: [279087]
   Other proteins in same PDB: d4zqka_
   automated match to d2m2da_
   complexed with na

Details for d4zqkb_

PDB Entry: 4zqk, 2.45 Å

PDB Description: structure of the complex of human programmed death-1 (pd-1) and its ligand pd-l1.

PDB Compounds: (B:) Programmed cell death protein 1

SCOPe Domain Sequences for d4zqkb_:

Sequence, based on SEQRES records:

>d4zqkb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Sequence, based on observed residues (ATOM records):

>d4zqkb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpesrfrvtql
pngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Timeline for d4zqkb_:

• d4zqkb_ first appeared in SCOPe 2.05
  
• d4zqkb_ appears in SCOPe 2.07