Lineage for d4zqkb_ (4zqk B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019420Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2019421Species Human (Homo sapiens) [TaxId:9606] [256383] (3 PDB entries)
  8. 2019422Domain d4zqkb_: 4zqk B: [279087]
    automated match to d2m2da_
    complexed with na

Details for d4zqkb_

PDB Entry: 4zqk (more details), 2.45 Å

PDB Description: structure of the complex of human programmed death-1 (pd-1) and its ligand pd-l1.
PDB Compounds: (B:) Programmed cell death protein 1

SCOPe Domain Sequences for d4zqkb_:

Sequence, based on SEQRES records: (download)

>d4zqkb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Sequence, based on observed residues (ATOM records): (download)

>d4zqkb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpesrfrvtql
pngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

SCOPe Domain Coordinates for d4zqkb_:

Click to download the PDB-style file with coordinates for d4zqkb_.
(The format of our PDB-style files is described here.)

Timeline for d4zqkb_: