Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (13 proteins) |
Protein Cystathionine gamma-synthase, CGS [53405] (2 species) |
Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries) |
Domain d1qgna_: 1qgn A: [34403] |
PDB Entry: 1qgn (more details), 2.9 Å
SCOP Domain Sequences for d1qgna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum)} mkyasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfe ygrygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktr ifietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklch ekgalvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnl hhilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpe hhiakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdl sqsdrakygimdnlvrfsfgvedfddlkadilqaldsi
Timeline for d1qgna_: