Lineage for d1qgna_ (1qgn A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26361Family c.67.1.3: Cystathionine synthase-like [53402] (6 proteins)
  6. 26386Protein Cystathionine gamma-synthase [53405] (2 species)
  7. 26387Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (1 PDB entry)
  8. 26388Domain d1qgna_: 1qgn A: [34403]

Details for d1qgna_

PDB Entry: 1qgn (more details), 2.9 Å

PDB Description: cystathionine gamma-synthase from nicotiana tabacum
PDB Compounds: (A:)

SCOP Domain Sequences for d1qgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase {Common tobacco (Nicotiana tabacum)}
mkyasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfe
ygrygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktr
ifietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklch
ekgalvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnl
hhilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpe
hhiakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdl
sqsdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOP Domain Coordinates for d1qgna_:

Click to download the PDB-style file with coordinates for d1qgna_.
(The format of our PDB-style files is described here.)

Timeline for d1qgna_: