Lineage for d3l5qs_ (3l5q S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602159Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2602189Domain d3l5qs_: 3l5q S: [343836]
    Other proteins in same PDB: d3l5q1_, d3l5q2_, d3l5q3_, d3l5q4_, d3l5qa_, d3l5qb1, d3l5qb2, d3l5qc_, d3l5qd1, d3l5qd2, d3l5qh_, d3l5qi_, d3l5qk_, d3l5ql_, d3l5qm_, d3l5qn_, d3l5qo_, d3l5qp_, d3l5qq_, d3l5qr_, d3l5qt_, d3l5qu_, d3l5qw_, d3l5qx_, d3l5qy_, d3l5qz_
    automated match to d5l64k_

Details for d3l5qs_

PDB Entry: 3l5q (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (S:) Proteasome component Y7

SCOPe Domain Sequences for d3l5qs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5qs_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qidyaltavkqgvtslgikatngvviatekksssplamsetlskvslltpdigavysgmg
pdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqsggvrpfgvslliagh
defngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndeleledaihialltlkes
vegefngdtielaiigdenpdllgytgiptdkgprfrkltsqeindrleal

SCOPe Domain Coordinates for d3l5qs_:

Click to download the PDB-style file with coordinates for d3l5qs_.
(The format of our PDB-style files is described here.)

Timeline for d3l5qs_: