SCOPe 2.08: Domain d5xfya_: 5xfy A:

Lineage for d5xfya_ (5xfy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)

8. Domain d5xfya_: 5xfy A: [343273]
   automated match to d4eb0a_
   complexed with gol, so4; mutant

Details for d5xfya_

PDB Entry: 5xfy, 1.4 Å

PDB Description: crystal structure of a novel pet hydrolase s131a mutant from ideonella sakaiensis 201-f6

PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d5xfya_:

Sequence; same for both SEQRES and ATOM records:

>d5xfya_ c.69.1.0 (A:) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygkv
dtarmgvmgwamggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
tfacenpnstrvsdfrtancs

Timeline for d5xfya_:

• d5xfya_ first appeared in SCOPe 2.06
  
• d5xfya_ appears in SCOPe 2.07