Lineage for d5xfya_ (5xfy A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153086Species Ideonella sakaiensis [TaxId:1547922] [343272] (5 PDB entries)
  8. 2153089Domain d5xfya_: 5xfy A: [343273]
    automated match to d4eb0a_
    complexed with gol, so4; mutant

Details for d5xfya_

PDB Entry: 5xfy (more details), 1.4 Å

PDB Description: crystal structure of a novel pet hydrolase s131a mutant from ideonella sakaiensis 201-f6
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d5xfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfya_ c.69.1.0 (A:) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygkv
dtarmgvmgwamggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
tfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d5xfya_:

Click to download the PDB-style file with coordinates for d5xfya_.
(The format of our PDB-style files is described here.)

Timeline for d5xfya_: