Lineage for d5mmga_ (5mmg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706707Domain d5mmga_: 5mmg A: [343136]
    automated match to d4nyva_
    complexed with ut0

Details for d5mmga_

PDB Entry: 5mmg (more details), 1.23 Å

PDB Description: crystal structure of crebbp bromodomain complexed with ut07c
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5mmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmga_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d5mmga_:

Click to download the PDB-style file with coordinates for d5mmga_.
(The format of our PDB-style files is described here.)

Timeline for d5mmga_: