| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
| Protein automated matches [190561] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
| Domain d6bn5b1: 6bn5 B:4-110 [342934] Other proteins in same PDB: d6bn5a3, d6bn5b2 automated match to d2shpa2 complexed with dzj |
PDB Entry: 6bn5 (more details), 2.22 Å
SCOPe Domain Sequences for d6bn5b1:
Sequence, based on SEQRES records: (download)
>d6bn5b1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
>d6bn5b1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpspgdftlsvrrngavthikiqntgdyydly
ggekfatlaelvqyymehelkyplncadpe
Timeline for d6bn5b1: