SCOPe 2.06: Domain d5opfa_: 5opf A:

Lineage for d5opfa_ (5opf A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Micromonospora aurantiaca [TaxId:644283] [342823] (1 PDB entry)

8. Domain d5opfa_: 5opf A: [342824]
   automated match to d4oy6a_
   complexed with cu

Details for d5opfa_

PDB Entry: 5opf, 1.08 Å

PDB Description: structure of lpmo10b from from micromonospora aurantiaca

PDB Compounds: (A:) Chitin-binding domain 3 protein

SCOPe Domain Sequences for d5opfa_:

Sequence; same for both SEQRES and ATOM records:

>d5opfa_ b.1.18.0 (A:) automated matches {Micromonospora aurantiaca [TaxId: 644283]}
hgsvvdpasrsyscwqrwggdfqnpamatqdpmcwqawqadpnamwnwnglfregvagnh
qgaipdgqlcsggrtqsgrynaldtvgawktvpvtnnfrvkffdqashgadyirvyvtkq
gynaltsplrwsdlelvgqigntpasqwtrevdgvsiqipanapgrtgrhvvytiwqash
ldqsyylcsdvdfg

Timeline for d5opfa_:

• d5opfa_ is new in SCOPe 2.06-stable
  
• d5opfa_ appears in SCOPe 2.07
  
• d5opfa_ appears in the current release, SCOPe 2.08