Lineage for d6b00a1 (6b00 A:4-261)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2420951Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries)
    Uniprot P00918
  8. 2420975Domain d6b00a1: 6b00 A:4-261 [342803]
    Other proteins in same PDB: d6b00a2
    automated match to d2foua_
    complexed with gol, zn; mutant

Details for d6b00a1

PDB Entry: 6b00 (more details), 0.9 Å

PDB Description: thermostabilized mutant of human carbonic anhydrase ii - a65t l100h k154n l224s l240p a248t
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d6b00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b00a1 b.74.1.1 (A:4-261) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
htfnvefddsqdkavlkggpldgtyrliqfhfhwgshdgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsanpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvskfrklnfngegepeepmvdn
wrptqplknrqikasfk

SCOPe Domain Coordinates for d6b00a1:

Click to download the PDB-style file with coordinates for d6b00a1.
(The format of our PDB-style files is described here.)

Timeline for d6b00a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b00a2