Lineage for d6b04a_ (6b04 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344939Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2344940Protein automated matches [196409] (45 species)
    not a true protein
  7. 2344950Species Choristoneura fumiferana [TaxId:7141] [342677] (4 PDB entries)
  8. 2344951Domain d6b04a_: 6b04 A: [342696]
    automated match to d4demf_
    complexed with c6j, edo, mg

Details for d6b04a_

PDB Entry: 6b04 (more details), 1.83 Å

PDB Description: crystal structure of cffpps2, a lepidopteran type-ii farnesyl diphosphate synthase, complexed with [2-(1-methylpyridin-2-yl)-1- phosphono-ethyl]phosphonic acid (inhibitor 1b)
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d6b04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b04a_ a.128.1.0 (A:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
sltgkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpe
lyaqeetrmyeslikqahglpselspalfvrlihmiykrnh

SCOPe Domain Coordinates for d6b04a_:

Click to download the PDB-style file with coordinates for d6b04a_.
(The format of our PDB-style files is described here.)

Timeline for d6b04a_: