SCOPe 2.06: Domain d6b07a_: 6b07 A:

Lineage for d6b07a_ (6b07 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (37 species)
   not a true protein

7. Species Choristoneura fumiferana [TaxId:7141] [342677] (4 PDB entries)

8. Domain d6b07a_: 6b07 A: [342694]
   automated match to d4demf_
   complexed with c6m, edo, mg

Details for d6b07a_

PDB Entry: 6b07, 1.98 Å

PDB Description: crystal structure of cffpps2, a lepidopteran type-ii farnesyl diphosphate synthase, complexed with [1-phosphono-2-(1-propylpyridin- 2-yl)ethyl]phosphonic acid (inhibitor 1d)

PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d6b07a_:

Sequence; same for both SEQRES and ATOM records:

>d6b07a_ a.128.1.0 (A:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
sltgkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpe
lyaqeetrmyeslikqahglpselspalfvrlihmiykrnh

Timeline for d6b07a_:

• d6b07a_ is new in SCOPe 2.06-stable
  
• d6b07a_ appears in SCOPe 2.07
  
• d6b07a_ appears in the current release, SCOPe 2.08