Lineage for d1mapa_ (1map A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613160Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1613220Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 1613231Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [53386] (15 PDB entries)
  8. 1613249Domain d1mapa_: 1map A: [34267]
    complexed with ket

Details for d1mapa_

PDB Entry: 1map (more details), 2.4 Å

PDB Description: crystal structures of true enzymatic reaction intermediates: aspartate and glutamate ketimines in aspartate aminotransferase
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d1mapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mapa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]}
sswwshvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlncvrkaeamiaa
kkmdkeylpiagladftrasaelalgenseafksgryvtvqgisgtgslrvganflqrff
kfsrdvylpkpswgnhtpifrdaglqlqayryydpktcsldftgamediskipeksiill
hacahnptgvdprqeqwkelasvvkkrnllayfdmayqgfasgdinrdawalrhfieqgi
dvvlsqsyaknmglygeragaftvicrdaeeakrvesqlkilirpmysnppmngariasl
ilntpelrkewlvevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
qverltkefsiymtkdgrisvagvassnvgylahaihqvtk

SCOPe Domain Coordinates for d1mapa_:

Click to download the PDB-style file with coordinates for d1mapa_.
(The format of our PDB-style files is described here.)

Timeline for d1mapa_: