![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) |
![]() | Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (27 PDB entries) Uniprot P23295 |
![]() | Domain d5y5kb_: 5y5k B: [342630] automated match to d1geja_ complexed with hem, no |
PDB Entry: 5y5k (more details), 2.1 Å
SCOPe Domain Sequences for d5y5kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y5kb_ a.104.1.1 (B:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
Timeline for d5y5kb_: