Lineage for d5y5kb_ (5y5k B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331415Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 2331416Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (25 PDB entries)
    Uniprot P23295
  8. 2331445Domain d5y5kb_: 5y5k B: [342630]
    automated match to d1geja_
    complexed with hem, no

Details for d5y5kb_

PDB Entry: 5y5k (more details), 2.1 Å

PDB Description: time-resolved sfx structure of cytochrome p450nor : 20 ms after photo- irradiation of caged no in the absence of nadh (no-bound state), light data
PDB Compounds: (B:) NADP nitrous oxide-forming nitric oxide reductase

SCOPe Domain Sequences for d5y5kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5kb_ a.104.1.1 (B:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOPe Domain Coordinates for d5y5kb_:

Click to download the PDB-style file with coordinates for d5y5kb_.
(The format of our PDB-style files is described here.)

Timeline for d5y5kb_: