Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (19 species) not a true protein |
Species White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId:654913] [342590] (3 PDB entries) |
Domain d5y5oa_: 5y5o A: [342621] automated match to d3c3ib_ |
PDB Entry: 5y5o (more details), 2.4 Å
SCOPe Domain Sequences for d5y5oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y5oa_ b.85.4.0 (A:) automated matches {White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId: 654913]} ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl rycdveeeqivyinettgertiidsssk
Timeline for d5y5oa_: