Lineage for d5y5qa_ (5y5q A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427858Species White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId:654913] [342590] (3 PDB entries)
  8. 2427859Domain d5y5qa_: 5y5q A: [342616]
    automated match to d3c3ib_
    complexed with dut, mg; mutant

Details for d5y5qa_

PDB Entry: 5y5q (more details), 1.56 Å

PDB Description: crystal structure of the wssv dutpase d88n/r158e mutant in complex with dutp
PDB Compounds: (A:) Wsv112

SCOPe Domain Sequences for d5y5qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5qa_ b.85.4.0 (A:) automated matches {White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId: 654913]}
ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
gcygqivsrsgmtwknntsvptgtinvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
rycdveeeqivyinettgertiidsssk

SCOPe Domain Coordinates for d5y5qa_:

Click to download the PDB-style file with coordinates for d5y5qa_.
(The format of our PDB-style files is described here.)

Timeline for d5y5qa_: