Lineage for d5y5pc_ (5y5p C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427858Species White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId:654913] [342590] (3 PDB entries)
  8. 2427864Domain d5y5pc_: 5y5p C: [342614]
    automated match to d3ehwb_
    complexed with dur, mg, pop

Details for d5y5pc_

PDB Entry: 5y5p (more details), 2.03 Å

PDB Description: crystal structure of the dutpase of white spot syndrome virus in complex with du,ppi and mg2+
PDB Compounds: (C:) Wsv112

SCOPe Domain Sequences for d5y5pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5pc_ b.85.4.0 (C:) automated matches {White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId: 654913]}
dssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfp
dgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlif
lrycdveeeqivyinettgertiidsssk

SCOPe Domain Coordinates for d5y5pc_:

Click to download the PDB-style file with coordinates for d5y5pc_.
(The format of our PDB-style files is described here.)

Timeline for d5y5pc_: