Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.0: automated matches [227191] (1 protein) not a true family |
Protein automated matches [226914] (2 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [341801] (2 PDB entries) |
Domain d5ww0a_: 5ww0 A: [342543] Other proteins in same PDB: d5ww0b2 automated match to d3kmta_ complexed with so4 |
PDB Entry: 5ww0 (more details), 2.1 Å
SCOPe Domain Sequences for d5ww0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ww0a_ b.85.7.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} ripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqytvlneyty vwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcisygdhlwf ede
Timeline for d5ww0a_: