Lineage for d1dctb_ (1dct B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399649Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)
  6. 399650Protein DNA methylase HaeIII [53371] (1 species)
  7. 399651Species Haemophilus aegyptius [TaxId:197575] [53372] (1 PDB entry)
  8. 399653Domain d1dctb_: 1dct B: [34245]
    protein/DNA complex; complexed with ca, ch3, flo

Details for d1dctb_

PDB Entry: 1dct (more details), 2.8 Å

PDB Description: dna (cytosine-5) methylase from haeiii covalently bound to dna

SCOP Domain Sequences for d1dctb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dctb_ c.66.1.26 (B:) DNA methylase HaeIII {Haemophilus aegyptius}
mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
kcdgiiggppcqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
ykmignavpvnlayeiaktiksal

SCOP Domain Coordinates for d1dctb_:

Click to download the PDB-style file with coordinates for d1dctb_.
(The format of our PDB-style files is described here.)

Timeline for d1dctb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dcta_