SCOP 1.71: Domain d1mhta_: 1mht A:

Lineage for d1mhta_ (1mht A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)

6. Protein DNA methylase HhaI [53367] (1 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (15 PDB entries)

8. Domain d1mhta_: 1mht A: [34236]
   protein/DNA complex; complexed with ch3, flo, sah, thm

Details for d1mhta_

PDB Entry: 1mht, 2.8 Å

PDB Description: covalent ternary structure of hhai methyltransferase, dna and s- adenosyl-l-homocysteine

SCOP Domain Sequences for d1mhta_:

Sequence; same for both SEQRES and ATOM records:

>d1mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d1mhta_:

• d1mhta_ first appeared (with stable ids) in SCOP 1.55
  
• d1mhta_ appears in SCOP 1.69
  
• d1mhta_ appears in SCOP 1.73
  
• d1mhta_ appears in the current release, SCOPe 2.08